Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (6 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801) |
Protein Hypothetical protein EF0647 [140309] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [140310] (1 PDB entry) Uniprot Q838C3 1-108 |
Domain d1z7ua1: 1z7u A:1-108 [124672] Other proteins in same PDB: d1z7ub_ complexed with fmt |
PDB Entry: 1z7u (more details), 2.2 Å
SCOPe Domain Sequences for d1z7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarln
Timeline for d1z7ua1: