SCOPe 2.03: Domain d1z7ua1: 1z7u A:1-108

Lineage for d1z7ua1 (1z7u A:1-108)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (6 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)

6. Protein Hypothetical protein EF0647 [140309] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140310] (1 PDB entry)
   Uniprot Q838C3 1-108

8. Domain d1z7ua1: 1z7u A:1-108 [124672]
   Other proteins in same PDB: d1z7ub_
   complexed with fmt

Details for d1z7ua1

PDB Entry: 1z7u, 2.2 Å

PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583

PDB Compounds: (A:) hypothetical protein EF0647

SCOPe Domain Sequences for d1z7ua1:

Sequence; same for both SEQRES and ATOM records:

>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]}
mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd
glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarln

Timeline for d1z7ua1:

• d1z7ua1 first appeared in SCOP 1.73
  
• d1z7ua1 appears in SCOPe 2.02
  
• d1z7ua1 appears in SCOPe 2.04
  
• d1z7ua1 appears in the current release, SCOPe 2.08