PDB entry 1z7u

View 1z7u on RCSB PDB site
Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: winged-helix-turn-helix, MarR, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-03-28, released 2005-05-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein EF0647
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838C3 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (41)
      • modified residue (59)
    Domains in SCOPe 2.03: d1z7ua1
  • Chain 'B':
    Compound: hypothetical protein EF0647
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838C3 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (41)
      • modified residue (59)
    Domains in SCOPe 2.03: d1z7ub_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1z7uA (A:)
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarlnk

    Sequence, based on observed residues (ATOM records): (download) 
    >1z7uA (A:)
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarln

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1z7uB (B:)
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarlnk

    Sequence, based on observed residues (ATOM records): (download) 
    >1z7uB (B:)
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl