Lineage for d1z6ou_ (1z6o U:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486725Species Trichoplusia ni [TaxId:7111] [186900] (1 PDB entry)
  8. 1486733Domain d1z6ou_: 1z6o U: [124551]
    Other proteins in same PDB: d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1
    automated match to d1rcd__
    complexed with ca, fe

Details for d1z6ou_

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (U:) ferritin heavy chain

SCOPe Domain Sequences for d1z6ou_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6ou_ a.25.1.0 (U:) automated matches {Trichoplusia ni [TaxId: 7111]}
tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
ifdkkllgidv

SCOPe Domain Coordinates for d1z6ou_:

Click to download the PDB-style file with coordinates for d1z6ou_.
(The format of our PDB-style files is described here.)

Timeline for d1z6ou_: