Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Helicase of the SNF2/Rad54 hamily [142312] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [142313] (3 PDB entries) Uniprot Q97XQ7 432-661! Uniprot Q97XQ7 662-802! Uniprot Q97XQ7 663-802 |
Domain d1z6aa1: 1z6a A:432-661 [124508] automatically matched to 1Z63 A:432-661 complexed with hg, po4 |
PDB Entry: 1z6a (more details), 3 Å
SCOPe Domain Sequences for d1z6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6aa1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp
Timeline for d1z6aa1: