Lineage for d1z5aa3 (1z5a A:4-228)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667730Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 1667769Protein Topoisomerase VI-B subunit [82778] (1 species)
    contains an H2TH domain inserted after this domain and before the second family-specific domain
  7. 1667770Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)
  8. 1667778Domain d1z5aa3: 1z5a A:4-228 [124460]
    Other proteins in same PDB: d1z5aa1, d1z5aa2, d1z5ab1, d1z5ab2
    automated match to d2hkja3
    complexed with adp, mg

Details for d1z5aa3

PDB Entry: 1z5a (more details), 2.2 Å

PDB Description: Topoisomerase VI-B, ADP-bound dimer form
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5aa3 d.122.1.2 (A:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

SCOPe Domain Coordinates for d1z5aa3:

Click to download the PDB-style file with coordinates for d1z5aa3.
(The format of our PDB-style files is described here.)

Timeline for d1z5aa3: