Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein) automatically mapped to Pfam PF05833 |
Protein Topoisomerase VI-B subunit middle domain [81706] (1 species) |
Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries) |
Domain d1z5aa1: 1z5a A:229-306 [124458] Other proteins in same PDB: d1z5aa2, d1z5aa3, d1z5ab2, d1z5ab3 automatically matched to d1mu5a1 complexed with adp, mg |
PDB Entry: 1z5a (more details), 2.2 Å
SCOPe Domain Sequences for d1z5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5aa1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]} vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl teeeitrlvetfkkyedf
Timeline for d1z5aa1: