Lineage for d1z5aa1 (1z5a A:229-306)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735434Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
    automatically mapped to Pfam PF05833
  6. 2735435Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 2735436Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 2735444Domain d1z5aa1: 1z5a A:229-306 [124458]
    Other proteins in same PDB: d1z5aa2, d1z5aa3, d1z5ab2, d1z5ab3
    automated match to d2hkja1
    complexed with adp, mg

Details for d1z5aa1

PDB Entry: 1z5a (more details), 2.2 Å

PDB Description: Topoisomerase VI-B, ADP-bound dimer form
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1z5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5aa1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOPe Domain Coordinates for d1z5aa1:

Click to download the PDB-style file with coordinates for d1z5aa1.
(The format of our PDB-style files is described here.)

Timeline for d1z5aa1: