Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
Protein automated matches [190170] (17 species) not a true protein |
Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186898] (3 PDB entries) |
Domain d1z3wa_: 1z3w A: [124415] automated match to d1gpia_ complexed with idc, nag |
PDB Entry: 1z3w (more details), 1.7 Å
SCOPe Domain Sequences for d1z3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3wa_ b.29.1.10 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]} eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf gdigstfsgts
Timeline for d1z3wa_: