SCOPe 2.07: Domain d1z3wa_: 1z3w A:

Lineage for d1z3wa_ (1z3w A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein automated matches [190170] (17 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186898] (3 PDB entries)

8. Domain d1z3wa_: 1z3w A: [124415]
   automated match to d1gpia_
   complexed with idc, nag

Details for d1z3wa_

PDB Entry: 1z3w, 1.7 Å

PDB Description: structure of phanerochaete chrysosporium cellobiohydrolase cel7d (cbh58) in complex with cellobioimidazole

PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d1z3wa_:

Sequence; same for both SEQRES and ATOM records:

>d1z3wa_ b.29.1.10 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
gdigstfsgts

Timeline for d1z3wa_:

• d1z3wa_ first appeared in SCOP 1.73, called d1z3wa1
  
• d1z3wa_ appears in SCOPe 2.06
  
• d1z3wa_ appears in the current release, SCOPe 2.08