Lineage for d1z3ca1 (1z3c A:41-292)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176480Family c.66.1.34: mRNA cap (Guanine N-7) methyltransferase [102560] (1 protein)
    mRNA capping enzyme
  6. 1176481Protein mRNA cap (Guanine N-7) methyltransferase [102561] (1 species)
  7. 1176482Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [102562] (7 PDB entries)
  8. 1176484Domain d1z3ca1: 1z3c A:41-292 [124398]
    automatically matched to d1ri1a_
    protein/RNA complex; complexed with sa8

Details for d1z3ca1

PDB Entry: 1z3c (more details), 2.2 Å

PDB Description: Encephalitozooan cuniculi mRNA Cap (Guanine-N7) Methyltransferasein complexed with AzoAdoMet
PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1z3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ca1 c.66.1.34 (A:41-292) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sktinirnannfikaclirlytkrgdsvldlgcgkggdllkyeragigeyygvdiaevsi
ndarvrarnmkrrfkvffraqdsygrhmdlgkefdvissqfsfhyafstsesldiaqrni
arhlrpggyfimtvpsrdvilerykqgrmsndfykielekmedvpmesvreyrftlldsv
nncieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskkmglgcltreesev
vgiyevvvfrkl

SCOPe Domain Coordinates for d1z3ca1:

Click to download the PDB-style file with coordinates for d1z3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ca1: