Lineage for d1z2xa_ (1z2x A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
Family d.159.1.7: YfcE-like [111233] (5 proteins) Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) 
Species Mouse (Mus musculus) [TaxId:10090] [143936] (6 PDB entries)
Uniprot Q9QZ88 1-182
Domain d1z2xa_: 1z2x A: [124392]
automated match to d1z2wa1
Details for d1z2xa_
PDB Entry: 1z2x (more details), 2.22 Å
PDB Description: Crystal structure of mouse Vps29
PDB Compounds: (A:) vacuolar protein sorting 29SCOPe Domain Sequences for d1z2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2xa_ d.159.1.7 (A:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks
SCOPe Domain Coordinates for d1z2xa_:
Click to download the PDB-style file with coordinates for d1z2xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z2xa_:
- d1z2xa_ first appeared in SCOP 1.73, called d1z2xa1
- d1z2xa_ appears in SCOPe 2.07
View in 3D
