Lineage for d1z2xb_ (1z2x B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998354Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2998372Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 2998387Species Mouse (Mus musculus) [TaxId:10090] [143936] (6 PDB entries)
    Uniprot Q9QZ88 1-182
  8. 2998391Domain d1z2xb_: 1z2x B: [124393]
    automated match to d1z2wa1

Details for d1z2xb_

PDB Entry: 1z2x (more details), 2.22 Å

PDB Description: Crystal structure of mouse Vps29
PDB Compounds: (B:) vacuolar protein sorting 29

SCOPe Domain Sequences for d1z2xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2xb_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

SCOPe Domain Coordinates for d1z2xb_:

Click to download the PDB-style file with coordinates for d1z2xb_.
(The format of our PDB-style files is described here.)

Timeline for d1z2xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z2xa_