SCOP 1.75: Domain d1z2ma1: 1z2m A:3-78

Lineage for d1z2ma1 (1z2m A:3-78)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein Interferon-induced 15 kDa protein [142936] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142937] (1 PDB entry)
   Uniprot P05161 2-77! Uniprot P05161 78-153

8. Domain d1z2ma1: 1z2m A:3-78 [124387]
   complexed with os4; mutant

Details for d1z2ma1

PDB Entry: 1z2m, 2.5 Å

PDB Description: crystal structure of isg15, the interferon-induced ubiquitin cross reactive protein

PDB Compounds: (A:) interferon, alpha-inducible protein (clone IFI-15K)

SCOP Domain Sequences for d1z2ma1:

Sequence; same for both SEQRES and ATOM records:

>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]}
wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
qglgpgstvllvvdks

Timeline for d1z2ma1:

• d1z2ma1 first appeared in SCOP 1.73
  
• d1z2ma1 appears in SCOPe 2.01
  
• d1z2ma1 appears in the current release, SCOPe 2.08