Lineage for d1z2ma1 (1z2m A:3-78)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717129Protein Interferon-induced 15 kDa protein [142936] (1 species)
  7. 717130Species Human (Homo sapiens) [TaxId:9606] [142937] (1 PDB entry)
  8. 717131Domain d1z2ma1: 1z2m A:3-78 [124387]
    complexed with os4; mutant

Details for d1z2ma1

PDB Entry: 1z2m (more details), 2.5 Å

PDB Description: Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein
PDB Compounds: (A:) interferon, alpha-inducible protein (clone IFI-15K)

SCOP Domain Sequences for d1z2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]}
wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
qglgpgstvllvvdks

SCOP Domain Coordinates for d1z2ma1:

Click to download the PDB-style file with coordinates for d1z2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1z2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z2ma2