Lineage for d1z05a3 (1z05 A:81-208)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858310Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 1858357Protein Transcriptional regulator VC2007 [142479] (1 species)
  7. 1858358Species Vibrio cholerae [TaxId:666] [142480] (1 PDB entry)
    Uniprot Q9KQJ1 209-405! Uniprot Q9KQJ1 81-208
  8. 1858360Domain d1z05a3: 1z05 A:81-208 [124300]
    Other proteins in same PDB: d1z05a1
    complexed with bme, gol, so4, zn

Details for d1z05a3

PDB Entry: 1z05 (more details), 2 Å

PDB Description: crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
PDB Compounds: (A:) transcriptional regulator, ROK family

SCOPe Domain Sequences for d1z05a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]}
nlgwqflsmrlgrgyltialhelggevlidtkidiheidqddvlarllfeieeffqtyaa
qldrvtsiaitlpglvnseqgivlqmphynvknlalgpeiykatglpvfvandtrawala
eklfghsq

SCOPe Domain Coordinates for d1z05a3:

Click to download the PDB-style file with coordinates for d1z05a3.
(The format of our PDB-style files is described here.)

Timeline for d1z05a3: