SCOPe 2.07: Domain d1yxca_: 1yxc A:

Lineage for d1yxca_ (1yxc A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (13 species)

7. Species Escherichia coli [TaxId:562] [51575] (17 PDB entries)

8. Domain d1yxca_: 1yxc A: [124183]
   automated match to d1dhpa_
   complexed with cl, k

Details for d1yxca_

PDB Entry: 1yxc, 1.9 Å

PDB Description: structure of e. coli dihydrodipicolinate synthase to 1.9 a

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1yxca_:

Sequence; same for both SEQRES and ATOM records:

>d1yxca_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

Timeline for d1yxca_:

• d1yxca_ first appeared in SCOP 1.73, called d1yxca1
  
• d1yxca_ appears in SCOPe 2.06
  
• d1yxca_ appears in the current release, SCOPe 2.08