Lineage for d1yvoa1 (1yvo A:4-172)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037213Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1037354Protein Hypothetical protein PA4866 [143694] (1 species)
    Putative phosphinothricin acetyltransferase
  7. 1037355Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
    Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172
  8. 1037360Domain d1yvoa1: 1yvo A:4-172 [124106]
    Other proteins in same PDB: d1yvob_

Details for d1yvoa1

PDB Entry: 1yvo (more details), 1.9 Å

PDB Description: hypothetical acetyltransferase from P.aeruginosa PA01
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1yvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaag
evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai
esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

SCOPe Domain Coordinates for d1yvoa1:

Click to download the PDB-style file with coordinates for d1yvoa1.
(The format of our PDB-style files is described here.)

Timeline for d1yvoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yvob_