Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
Domain d1yuwa2: 1yuw A:2-188 [124071] Other proteins in same PDB: d1yuwa1 automatically matched to d1atr_1 mutant |
PDB Entry: 1yuw (more details), 2.6 Å
SCOPe Domain Sequences for d1yuwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuwa2 c.55.1.1 (A:2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai aygldkk
Timeline for d1yuwa2: