PDB entry 1yuw

View 1yuw on RCSB PDB site
Description: crystal structure of bovine hsc70(aa1-554)E213A/D214A mutant
Class: chaperone
Keywords: chaperone
Deposited on 2005-02-14, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock cognate 71 kDa protein
    Species: Bos taurus [TaxId:9913]
    Gene: HSPA8, HSC70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19120 (0-553)
      • engineered (212-213)
    Domains in SCOPe 2.07: d1yuwa1, d1yuwa2, d1yuwa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuwA (A:)
    mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggtfdvsiltiaagifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaailsgdksenvqdlllldvtplslgietaggvmtvlikrntti
    ptkqtqtfttysdnqpgvliqvyegeramtkdnnllgkfeltgippaprgvpqievtfdi
    dangilnvsavdkstgkenkititndkgrlskediermvqeaekykaedekqrdkvsskn
    slesyafnmkatve