Lineage for d1yuwa1 (1yuw A:385-543)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967347Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 967348Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 967349Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (2 proteins)
  6. 967353Protein DnaK [100922] (3 species)
  7. 967365Species Norway rat (Rattus norvegicus) [TaxId:10116] [56782] (3 PDB entries)
  8. 967366Domain d1yuwa1: 1yuw A:385-543 [124070]
    Other proteins in same PDB: d1yuwa2, d1yuwa3
    automatically matched to d1ckra_
    mutant

Details for d1yuwa1

PDB Entry: 1yuw (more details), 2.6 Å

PDB Description: crystal structure of bovine hsc70(aa1-554)e213a/d214a mutant
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d1yuwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
ndkgrlskediermvqeaekykaedekqrdkvssknsle

SCOPe Domain Coordinates for d1yuwa1:

Click to download the PDB-style file with coordinates for d1yuwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yuwa1: