SCOP 1.73: Domain d1ytvb1: 1ytv B:15-380

Lineage for d1ytvb1 (1ytv B:15-380)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (45 PDB entries)

8. Domain d1ytvb1: 1ytv B:15-380 [124017]
   automatically matched to d1mpb__
   complexed with mal

Details for d1ytvb1

PDB Entry: 1ytv, 1.8 Å

PDB Description: maltose-binding protein fusion to a c-terminal fragment of the v1a vasopressin receptor

PDB Compounds: (B:) Maltose-binding periplasmic protein

SCOP Domain Sequences for d1ytvb1:

Sequence; same for both SEQRES and ATOM records:

>d1ytvb1 c.94.1.1 (B:15-380) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqt

Timeline for d1ytvb1:

• d1ytvb1 is new in SCOP 1.73
  
• d1ytvb1 appears in SCOP 1.75
  
• d1ytvb1 appears in the current release, SCOPe 2.08, called d1ytvb_