SCOPe 2.04: Domain d1ytda1: 1ytd A:120-389

Lineage for d1ytda1 (1ytd A:120-389)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Nicotinate phosphoribosyltransferase Ta1145 [141861] (1 species)
   includes extra C-terminal region that wraps around the N-terminal domain and contains a rubredoxin-like subdomain

7. Species Thermoplasma acidophilum [TaxId:2303] [141862] (4 PDB entries)
   Uniprot Q9HJ28 120-389

8. Domain d1ytda1: 1ytd A:120-389 [124006]
   Other proteins in same PDB: d1ytda2

Details for d1ytda1

PDB Entry: 1ytd, 2.8 Å

PDB Description: Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum, Native Structure

PDB Compounds: (A:) nicotinate phosphoribosyltransferase from Thermoplasma acidophilum

SCOPe Domain Sequences for d1ytda1:

Sequence; same for both SEQRES and ATOM records:

>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]}
stkaskvrlaagdspffsfgirrmhpaispmidrsayiggadgvsgilgaklidqdpvgt
mphalsimlgdeeawkltlentkngqksvllidtymdekfaaikiaemfdkvdyirldtp
ssrrgnfealirevrwelalrgrsdikimvsggldentvkklreagaeafgvgtsissak
pfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqektcicggsmqnllv
kylshgkrtseyprpkeirsrsmkeleyfk

Timeline for d1ytda1:

• d1ytda1 first appeared in SCOP 1.73
  
• d1ytda1 appears in SCOPe 2.03
  
• d1ytda1 appears in SCOPe 2.05
  
• d1ytda1 appears in the current release, SCOPe 2.08