Lineage for d1ys7b1 (1ys7 B:128-233)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480304Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1480305Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 1480330Protein Transcriptional regulatory protein PrrA [140315] (1 species)
  7. 1480331Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries)
    Uniprot P0A5Z6 128-233
  8. 1480333Domain d1ys7b1: 1ys7 B:128-233 [123963]
    Other proteins in same PDB: d1ys7a2, d1ys7b2
    automated match to d1ys6a1
    complexed with act, gol, mg, trs

Details for d1ys7b1

PDB Entry: 1ys7 (more details), 1.58 Å

PDB Description: crystal structure of the response regulator protein prra complexed with mg2+
PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOPe Domain Sequences for d1ys7b1:

Sequence, based on SEQRES records: (download)

>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq

Sequence, based on observed residues (ATOM records): (download)

>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleaggprllhtvrgvgfvlrmq

SCOPe Domain Coordinates for d1ys7b1:

Click to download the PDB-style file with coordinates for d1ys7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ys7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ys7b2