Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.1: PhoB-like [46895] (5 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
Protein Transcriptional regulatory protein PrrA [140315] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries) Uniprot P0A5Z6 128-233 |
Domain d1ys7b1: 1ys7 B:128-233 [123963] Other proteins in same PDB: d1ys7a2, d1ys7b2 automated match to d1ys6a1 complexed with act, gol, mg, trs |
PDB Entry: 1ys7 (more details), 1.58 Å
SCOPe Domain Sequences for d1ys7b1:
Sequence, based on SEQRES records: (download)
>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]} statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq
>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]} statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel vwgydfaadtnvvdvfigylrrkleaggprllhtvrgvgfvlrmq
Timeline for d1ys7b1: