SCOP 1.73: Domain d1yrye1: 1yry E:3-284

Lineage for d1yrye1 (1yry E:3-284)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53170] (15 PDB entries)

8. Domain d1yrye1: 1yry E:3-284 [123947]
   automatically matched to d1ula__
   complexed with msg, so4

Details for d1yrye1

PDB Entry: 1yry, 2.8 Å

PDB Description: Crystal structure of human PNP complexed with MESG

PDB Compounds: (E:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1yrye1:

Sequence; same for both SEQRES and ATOM records:

>d1yrye1 c.56.2.1 (E:3-284) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
ngytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
ghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnp
kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmg
eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
nkvimdyeslekanheevlaagkqaaqkleqfvsilmasipl

Timeline for d1yrye1:

• d1yrye1 is new in SCOP 1.73
  
• d1yrye1 appears in SCOP 1.75
  
• d1yrye1 appears in the current release, SCOPe 2.08, called d1yrye_