SCOP 1.73: Domain d1yrxc1: 1yrx C:17-129

Lineage for d1yrxc1 (1yrx C:17-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families)

5. Family d.58.10.2: BLUF domain [143364] (3 proteins)
   Pfam PF04940; sensors of blue-light using FAD

6. Protein Sensor of blue light AppA [143367] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries)

8. Domain d1yrxc1: 1yrx C:17-129 [123946]
   automatically matched to 1YRX A:17-130
   complexed with d9g, fmn

Details for d1yrxc1

PDB Entry: 1yrx, 2.3 Å

PDB Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides

PDB Compounds: (C:) hypothetical protein Rsph03001874

SCOP Domain Sequences for d1yrxc1:

Sequence; same for both SEQRES and ATOM records:

>d1yrxc1 d.58.10.2 (C:17-129) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]}
vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm
thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv

Timeline for d1yrxc1:

• d1yrxc1 is new in SCOP 1.73
  
• d1yrxc1 appears in SCOP 1.75
  
• d1yrxc1 appears in the current release, SCOPe 2.08, called d1yrxc2