Lineage for d1yrxb1 (1yrx B:17-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724932Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families) (S)
  5. 724953Family d.58.10.2: BLUF domain [143364] (3 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 724970Protein Sensor of blue light AppA [143367] (1 species)
  7. 724971Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries)
  8. 724973Domain d1yrxb1: 1yrx B:17-129 [123945]
    automatically matched to 1YRX A:17-130
    complexed with d9g, fmn

Details for d1yrxb1

PDB Entry: 1yrx (more details), 2.3 Å

PDB Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides
PDB Compounds: (B:) hypothetical protein Rsph03001874

SCOP Domain Sequences for d1yrxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrxb1 d.58.10.2 (B:17-129) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]}
vsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavaevm
thiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv

SCOP Domain Coordinates for d1yrxb1:

Click to download the PDB-style file with coordinates for d1yrxb1.
(The format of our PDB-style files is described here.)

Timeline for d1yrxb1: