Lineage for d1yrhd1 (1yrh D:4-199)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1357110Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 1357119Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. 1357120Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. 1357132Domain d1yrhd1: 1yrh D:4-199 [123926]
    automatically matched to 1YRH A:4-199
    complexed with fmn

Details for d1yrhd1

PDB Entry: 1yrh (more details), 3.11 Å

PDB Description: crystal structure of trp repressor binding protein wrba in complex with fmn
PDB Compounds: (D:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1yrhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrhd1 c.23.5.8 (D:4-199) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
irhqvrrqveltakll

SCOPe Domain Coordinates for d1yrhd1:

Click to download the PDB-style file with coordinates for d1yrhd1.
(The format of our PDB-style files is described here.)

Timeline for d1yrhd1: