Lineage for d1yr0b_ (1yr0 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427410Species Agrobacterium tumefaciens [TaxId:176299] [186886] (1 PDB entry)
  8. 1427411Domain d1yr0b_: 1yr0 B: [123906]
    Other proteins in same PDB: d1yr0a1
    automated match to d1vhsa_
    complexed with so4

Details for d1yr0b_

PDB Entry: 1yr0 (more details), 2 Å

PDB Description: crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
PDB Compounds: (B:) phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1yr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr0b_ d.108.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

SCOPe Domain Coordinates for d1yr0b_:

Click to download the PDB-style file with coordinates for d1yr0b_.
(The format of our PDB-style files is described here.)

Timeline for d1yr0b_: