Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins) contains a single copy of this fold |
Protein 8-oxoguanine glycosylase [55955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) |
Domain d1yqra2: 1yqr A:12-135 [123898] Other proteins in same PDB: d1yqra1 automatically matched to d1ebma2 protein/DNA complex; complexed with ca |
PDB Entry: 1yqr (more details), 2.43 Å
SCOPe Domain Sequences for d1yqra2:
Sequence, based on SEQRES records: (download)
>d1yqra2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr llrq
>d1yqra2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr q
Timeline for d1yqra2: