| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (8 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
| Protein Oxidised low density lipoprotein [143955] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [143956] (5 PDB entries) |
| Domain d1ypob1: 1ypo B:142-270 [123826] automatically matched to 1YPQ A:140-270 |
PDB Entry: 1ypo (more details), 3 Å
SCOP Domain Sequences for d1ypob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypob1 d.169.1.1 (B:142-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
sicqkkanl
Timeline for d1ypob1: