Lineage for d1ynnb2 (1ynn B:50-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879239Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 879245Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries)
  8. 879251Domain d1ynnb2: 1ynn B:50-172 [123745]
    Other proteins in same PDB: d1ynna1, d1ynnb1, d1ynnc1, d1ynnd1, d1ynnk1
    automatically matched to d1i6va2
    complexed with rfp, zn

Details for d1ynnb2

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d1ynnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

SCOP Domain Coordinates for d1ynnb2:

Click to download the PDB-style file with coordinates for d1ynnb2.
(The format of our PDB-style files is described here.)

Timeline for d1ynnb2: