Class a: All alpha proteins [46456] (284 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.1: HD domain [101340] (14 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein Hypothetical protein AF1432 [140763] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [140764] (2 PDB entries) Uniprot O28840 7-172! Uniprot O28840 7-173 |
Domain d1ynbb_: 1ynb B: [123719] automated match to d1ynba1 |
PDB Entry: 1ynb (more details), 1.76 Å
SCOPe Domain Sequences for d1ynbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynbb_ a.211.1.1 (B:) Hypothetical protein AF1432 {Archaeoglobus fulgidus [TaxId: 2234]} mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
Timeline for d1ynbb_: