Lineage for d1ykwb1 (1ykw B:146-428)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088468Species Chlorobium tepidum [TaxId:1097] [117389] (2 PDB entries)
    Uniprot Q8KBL4 1-428
  8. 2088470Domain d1ykwb1: 1ykw B:146-428 [123567]
    Other proteins in same PDB: d1ykwa2, d1ykwb2
    automated match to d1ykwa1

Details for d1ykwb1

PDB Entry: 1ykw (more details), 2 Å

PDB Description: Crystal Structure of a Novel RuBisCO-Like Protein from the Green Sulfur Bacterium Chlorobium tepidum
PDB Compounds: (B:) RuBisCO-like protein

SCOPe Domain Sequences for d1ykwb1:

Sequence, based on SEQRES records: (download)

>d1ykwb1 c.1.14.1 (B:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad
vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina
lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg
drvmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv
fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq

Sequence, based on observed residues (ATOM records): (download)

>d1ykwb1 c.1.14.1 (B:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
egpkfgieglrdilnahgrpiffgvvkpnlspgefaeiayqswlggldiakddemladvt
wssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallinalp
vglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfgdr
vmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgvfg
hpmgpkagaksirqaweaieqgisietwaethpelqamvdq

SCOPe Domain Coordinates for d1ykwb1:

Click to download the PDB-style file with coordinates for d1ykwb1.
(The format of our PDB-style files is described here.)

Timeline for d1ykwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykwb2