Lineage for d1ykpg_ (1ykp G:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113967Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 1113968Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1113984Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1113992Species Pseudomonas putida [TaxId:303] [49487] (30 PDB entries)
  8. 1114141Domain d1ykpg_: 1ykp G: [123557]
    Other proteins in same PDB: d1ykpb_, d1ykpd_, d1ykpf_, d1ykph_, d1ykpj_, d1ykpl_
    automated match to d2pcda_
    complexed with dhb, fe; mutant

Details for d1ykpg_

PDB Entry: 1ykp (more details), 2.41 Å

PDB Description: protocatechuate 3,4-dioxygenase y408h mutant bound to dhb
PDB Compounds: (G:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1ykpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykpg_ b.3.6.1 (G:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d1ykpg_:

Click to download the PDB-style file with coordinates for d1ykpg_.
(The format of our PDB-style files is described here.)

Timeline for d1ykpg_: