Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries) Uniprot P09488 P28161 |
Domain d1ykca1: 1ykc A:85-217 [123509] Other proteins in same PDB: d1ykca2, d1ykcb2 automatically matched to d1hna_1 complexed with gds |
PDB Entry: 1ykc (more details), 2.1 Å
SCOPe Domain Sequences for d1ykca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykca1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp rpvftkmavwgnk
Timeline for d1ykca1: