SCOPe 2.02: Domain d1ykca1: 1ykc A:85-217

Lineage for d1ykca1 (1ykc A:85-217)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
   Uniprot P09488 P28161

8. Domain d1ykca1: 1ykc A:85-217 [123509]
   Other proteins in same PDB: d1ykca2, d1ykcb2
   automatically matched to d1hna_1
   complexed with gds

Details for d1ykca1

PDB Entry: 1ykc, 2.1 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with glutathione-disulfide

PDB Compounds: (A:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d1ykca1:

Sequence; same for both SEQRES and ATOM records:

>d1ykca1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

Timeline for d1ykca1:

• d1ykca1 first appeared in SCOP 1.73
  
• d1ykca1 appears in SCOPe 2.01
  
• d1ykca1 appears in SCOPe 2.03
  
• d1ykca1 appears in the current release, SCOPe 2.08