Lineage for d1yk3h1 (1yk3 H:10-206)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870160Protein Hypothetical protein Rv1347c/MT1389 [143668] (1 species)
  7. 870161Species Mycobacterium tuberculosis [TaxId:1773] [143669] (1 PDB entry)
    Uniprot P64819 10-207
  8. 870169Domain d1yk3h1: 1yk3 H:10-206 [123500]
    automatically matched to 1YK3 A:10-207
    complexed with bog

Details for d1yk3h1

PDB Entry: 1yk3 (more details), 2.2 Å

PDB Description: crystal structure of rv1347c from mycobacterium tuberculosis
PDB Compounds: (H:) Hypothetical protein Rv1347c/MT1389

SCOP Domain Sequences for d1yk3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk3h1 d.108.1.1 (H:10-206) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}
addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
ehdttnrrmalyaleap

SCOP Domain Coordinates for d1yk3h1:

Click to download the PDB-style file with coordinates for d1yk3h1.
(The format of our PDB-style files is described here.)

Timeline for d1yk3h1: