Lineage for d1yj9y1 (1yj9 Y:95-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851574Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2851575Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2851576Protein Ribosomal protein L32e [52044] (1 species)
  7. 2851577Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2851598Domain d1yj9y1: 1yj9 Y:95-236 [123417]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9z1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yj9y1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1yj9y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1yj9y1:

Click to download the PDB-style file with coordinates for d1yj9y1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9y1: