Lineage for d1yj9x1 (1yj9 X:7-88)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942215Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 2942216Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
    automatically mapped to Pfam PF01198
  5. 2942217Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 2942218Protein Ribosomal protein L31e [54577] (1 species)
  7. 2942219Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 2942239Domain d1yj9x1: 1yj9 X:7-88 [123416]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9y1, d1yj9z1
    automatically matched to d1ffku_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yj9x1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1yj9x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1yj9x1:

Click to download the PDB-style file with coordinates for d1yj9x1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9x1: