| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries) Uniprot P09488 ! Uniprot P28161 |
| Domain d1yj6c2: 1yj6 C:1-84 [123390] Other proteins in same PDB: d1yj6a1, d1yj6b1, d1yj6c1 automated match to d1xw6a2 complexed with gsh, zn |
PDB Entry: 1yj6 (more details), 2.5 Å
SCOPe Domain Sequences for d1yj6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yj6c2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn
Timeline for d1yj6c2:
View in 3DDomains from other chains: (mouse over for more information) d1yj6a1, d1yj6a2, d1yj6b1, d1yj6b2 |