SCOP 1.73: Domain d1yj6c2: 1yj6 C:1-84

Lineage for d1yj6c2 (1yj6 C:1-84)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)

8. Domain d1yj6c2: 1yj6 C:1-84 [123390]
   Other proteins in same PDB: d1yj6a1, d1yj6b1, d1yj6c1
   automatically matched to d1gtua2
   complexed with gsh, zn

Details for d1yj6c2

PDB Entry: 1yj6, 2.5 Å

PDB Description: crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide

PDB Compounds: (C:) Glutathione S-transferase Mu 1

SCOP Domain Sequences for d1yj6c2:

Sequence; same for both SEQRES and ATOM records:

>d1yj6c2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

Timeline for d1yj6c2:

• d1yj6c2 is new in SCOP 1.73
  
• d1yj6c2 appears in SCOP 1.75
  
• d1yj6c2 appears in the current release, SCOPe 2.08