SCOP 1.73: Domain d1yj5a1: 1yj5 A:144-338

Lineage for d1yj5a1 (1yj5 A:144-338)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins)
   no insertion subdomains

6. Protein 5' polynucleotide kinase-3' phosphatase, middle domain [142154] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142155] (1 PDB entry)

8. Domain d1yj5a1: 1yj5 A:144-338 [123380]
   Other proteins in same PDB: d1yj5a2, d1yj5b2, d1yj5c1
   complexed with so4

Details for d1yj5a1

PDB Entry: 1yj5, 2.8 Å

PDB Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme

PDB Compounds: (A:) 5' polynucleotide kinase-3' phosphatase catalytic domain

SCOP Domain Sequences for d1yj5a1:

Sequence; same for both SEQRES and ATOM records:

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}
lgweslkkllvftasgvkpqgkvaafdldgtlittrsgkvfptspsdwrilypeipkklq
elaaegyklviftnqmgigrgklpaevfkgkveavleklgvpfqvlvathaglnrkpvsg
mwdhlqeqanegipisvedsvfvgdaagrlanwapgrkkkdfscadrlfalnvglpfatp
eefflkwpaarfelp

Timeline for d1yj5a1:

• d1yj5a1 is new in SCOP 1.73
  
• d1yj5a1 appears in SCOP 1.75
  
• d1yj5a1 appears in the current release, SCOPe 2.08