Lineage for d1yj5a1 (1yj5 A:144-338)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848120Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins)
    no insertion subdomains
  6. 848121Protein 5' polynucleotide kinase-3' phosphatase, middle domain [142154] (1 species)
  7. 848122Species Mouse (Mus musculus) [TaxId:10090] [142155] (1 PDB entry)
    Uniprot Q9JLV6 144-338
  8. 848123Domain d1yj5a1: 1yj5 A:144-338 [123380]
    Other proteins in same PDB: d1yj5a2, d1yj5b2, d1yj5c1
    complexed with so4

Details for d1yj5a1

PDB Entry: 1yj5 (more details), 2.8 Å

PDB Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme
PDB Compounds: (A:) 5' polynucleotide kinase-3' phosphatase catalytic domain

SCOP Domain Sequences for d1yj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}
lgweslkkllvftasgvkpqgkvaafdldgtlittrsgkvfptspsdwrilypeipkklq
elaaegyklviftnqmgigrgklpaevfkgkveavleklgvpfqvlvathaglnrkpvsg
mwdhlqeqanegipisvedsvfvgdaagrlanwapgrkkkdfscadrlfalnvglpfatp
eefflkwpaarfelp

SCOP Domain Coordinates for d1yj5a1:

Click to download the PDB-style file with coordinates for d1yj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1yj5a1: