Lineage for d1yizb_ (1yiz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898246Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries)
  8. 2898250Domain d1yizb_: 1yiz B: [123376]
    automated match to d1w7la_
    complexed with br

Details for d1yizb_

PDB Entry: 1yiz (more details), 1.55 Å

PDB Description: Aedes aegypti kynurenine aminotrasferase
PDB Compounds: (B:) kynurenine aminotransferase; glutamine transaminase

SCOPe Domain Sequences for d1yizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yizb_ c.67.1.0 (B:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

SCOPe Domain Coordinates for d1yizb_:

Click to download the PDB-style file with coordinates for d1yizb_.
(The format of our PDB-style files is described here.)

Timeline for d1yizb_: