PDB entry 1yiz

View 1yiz on RCSB PDB site
Description: Aedes aegypti kynurenine aminotrasferase
Class: transferase
Keywords: kynurenine, kynurenic acid, kynurenine aminotransferase, Aedes, mosquito, PLP-enzyme, pyridoxal phosphate, PLP, transferase
Deposited on 2005-01-13, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.254
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine aminotransferase; glutamine transaminase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95VY4 (Start-428)
      • modified residue (254)
    Domains in SCOPe 2.07: d1yiza_
  • Chain 'B':
    Compound: kynurenine aminotransferase; glutamine transaminase
    Species: Aedes aegypti [TaxId:7159]
    Gene: KAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95VY4 (Start-428)
      • modified residue (254)
    Domains in SCOPe 2.07: d1yizb_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yizA (A:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yizA (A:)
    kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
    qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
    epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
    hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
    sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
    cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
    rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yizB (B:)
    msstsnetmhnkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnala
    aaanspdplanqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqg
    hvdegdeviiiepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfn
    ektkmiiintphnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictl
    pgmwertitigsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgf
    etelkrlkspecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvd
    ltqetdarkdyrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaae
    ilrkwkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yizB (B:)
    kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
    qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
    epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
    hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
    sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
    cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
    rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss