Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins) |
Protein Putative deoxyribonuclease YcfH [141809] (1 species) |
Species Escherichia coli [TaxId:562] [141810] (1 PDB entry) Uniprot P0AFQ7 1-265 |
Domain d1yixa1: 1yix A:1-265 [123371] complexed with zn |
PDB Entry: 1yix (more details), 1.9 Å
SCOP Domain Sequences for d1yixa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave elaqvttdnfarlfhidasrlqsir
Timeline for d1yixa1: