Lineage for d1yiwb1 (1yiw B:1-59)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048432Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 3048433Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 3048434Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 3048435Protein Ubiquitin [144347] (1 species)
  7. 3048436Species Synthetic [144348] (6 PDB entries)
  8. 3048441Domain d1yiwb1: 1yiw B:1-59 [123369]
    Other proteins in same PDB: d1yiwa2, d1yiwb2, d1yiwc2
    automatically matched to 1YIW A:1-71
    complexed with cd, cl

Details for d1yiwb1

PDB Entry: 1yiw (more details), 1.39 Å

PDB Description: x-ray crystal structure of a chemically synthesized ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1yiwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiwb1 k.45.1.1 (B:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy

SCOPe Domain Coordinates for d1yiwb1:

Click to download the PDB-style file with coordinates for d1yiwb1.
(The format of our PDB-style files is described here.)

Timeline for d1yiwb1:

3048441
d1yiwb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1yiwb2