![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
![]() | Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) ![]() automatically mapped to Pfam PF01198 |
![]() | Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
![]() | Protein Ribosomal protein L31e [54577] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
![]() | Domain d1yitx1: 1yit X:7-88 [123364] Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yity1, d1yitz1 automatically matched to d1ffku_ complexed with cd, cl, k, mg, na, vir |
PDB Entry: 1yit (more details), 2.8 Å
SCOPe Domain Sequences for d1yitx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yitx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d1yitx1:
![]() Domains from other chains: (mouse over for more information) d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yity1, d1yitz1 |