Lineage for d1yitw1 (1yit W:1-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956419Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2956420Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2956421Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2956422Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 2956423Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 2956439Domain d1yitw1: 1yit W:1-154 [123363]
    Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkt_
    complexed with cd, cl, k, mg, na, vir

    has additional subdomain(s) that are not in the common domain

Details for d1yitw1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1yitw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yitw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1yitw1:

Click to download the PDB-style file with coordinates for d1yitw1.
(The format of our PDB-style files is described here.)

Timeline for d1yitw1: