Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.1: PHM/PNGase F [49742] (2 families) members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) |
Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries) |
Domain d1yipa2: 1yip A:199-355 [123329] automated match to d1phma2 complexed with cu |
PDB Entry: 1yip (more details), 2.2 Å
SCOPe Domain Sequences for d1yipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yipa2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]} pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly imyymeakyalsfmtctknvapdmfrtipaeanipip
Timeline for d1yipa2: