Lineage for d1yigb_ (1yig B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286588Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1286589Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1286590Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1286591Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 1286592Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 1286601Domain d1yigb_: 1yig B: [123292]
    automated match to d1yiga1

Details for d1yigb_

PDB Entry: 1yig (more details), 2 Å

PDB Description: crystal structure of the human eb1 c-terminal dimerization domain
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1yigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yigb_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
d

SCOPe Domain Coordinates for d1yigb_:

Click to download the PDB-style file with coordinates for d1yigb_.
(The format of our PDB-style files is described here.)

Timeline for d1yigb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yiga1