Lineage for d1yifc2 (1yif C:2-324)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674809Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 674815Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 674816Family b.67.2.1: alpha-L-arabinanase-like [75006] (4 proteins)
  6. 674830Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 674834Species Bacillus subtilis [TaxId:1423] [141540] (1 PDB entry)
  8. 674837Domain d1yifc2: 1yif C:2-324 [123288]
    Other proteins in same PDB: d1yifa1, d1yifb1, d1yifc1, d1yifd1
    automatically matched to 1YIF A:2-324

Details for d1yifc2

PDB Entry: 1yif (more details), 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium
PDB Compounds: (C:) beta-1,4-xylosidase

SCOP Domain Sequences for d1yifc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yifc2 b.67.2.1 (C:2-324) Beta-D-xylosidase N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsql
dmkgnpnsggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepikl
nssgfdaslfhdtdgkkyllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtd
rklteaphlyhignyyylltaeggtryehaatiarsaniegpyevhpdnpiltswhdpgn
plqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgretaiqklywkdewp
yvvggkegslevdapsipetife

SCOP Domain Coordinates for d1yifc2:

Click to download the PDB-style file with coordinates for d1yifc2.
(The format of our PDB-style files is described here.)

Timeline for d1yifc2: