SCOP 1.73: Domain d1yifc2: 1yif C:2-324

Lineage for d1yifc2 (1yif C:2-324)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (4 proteins)

6. Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [141540] (1 PDB entry)

8. Domain d1yifc2: 1yif C:2-324 [123288]
   Other proteins in same PDB: d1yifa1, d1yifb1, d1yifc1, d1yifd1
   automatically matched to 1YIF A:2-324

Details for d1yifc2

PDB Entry: 1yif, 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium

PDB Compounds: (C:) beta-1,4-xylosidase

SCOP Domain Sequences for d1yifc2:

Sequence; same for both SEQRES and ATOM records:

>d1yifc2 b.67.2.1 (C:2-324) Beta-D-xylosidase N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsql
dmkgnpnsggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepikl
nssgfdaslfhdtdgkkyllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtd
rklteaphlyhignyyylltaeggtryehaatiarsaniegpyevhpdnpiltswhdpgn
plqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgretaiqklywkdewp
yvvggkegslevdapsipetife

Timeline for d1yifc2:

• d1yifc2 is new in SCOP 1.73
  
• d1yifc2 appears in SCOP 1.75
  
• d1yifc2 appears in the current release, SCOPe 2.08